Structure of PDB 2noq Chain G Binding Site BS02

Receptor Information
>2noq Chain G (length=213) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSL
KLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKL
SKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRS
TIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQNVGS
LVVKSSMGPAFRL
Ligand information
>2noq Chain E (length=53) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggaugcguaggauaggugggagcgcaagcgccggugaaauaccacccuu
ccc
<<<<...........<<<<<..<<....>>............>>>>>..>
>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2noq Structure of the ribosome-bound cricket paralysis virus IRES RNA.
Resolution7.3 Å
Binding residue
(original residue number in PDB)		Q35 K98 L99 K101 K102 K105 N108 Q127 K130 K156 Q158 K160 K161 V162 L163 C164 L165 A166
Binding residue
(residue number reindexed from 1)		Q32 K95 L96 K98 K99 K102 N105 Q124 K127 K153 Q155 K157 K158 V159 L160 C161 L162 A163
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2noq, PDBe:2noq, PDBj:2noq
PDBsum2noq
PubMed17115051
UniProtP0CX43|RL1A_YEAST Large ribosomal subunit protein uL1A (Gene Name=RPL1A)

[Back to BioLiP]