Structure of PDB 1u8r Chain G Binding Site BS02

Receptor Information

>1u8r Chain G (length=221) Species: 1773 (Mycobacterium tuberculosis)

MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPA
GSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVI
PGHENVTLPHEMAHAVKVEKV

Ligand information

>1u8r Chain L (length=33)

cactaaaattagggcagcctgtgctaacagggc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1u8r Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
• Resolution: 2.75 Å
• Binding residue (original residue number in PDB): N2 T7 Q36 S37 P39 T40 Q43 R47 R50
• Binding residue (residue number reindexed from 1): N2 T7 Q36 S37 P39 T40 Q43 R47 R50

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0008270 zinc ion binding
• GO:0016151 nickel cation binding
• GO:0030145 manganese ion binding
• GO:0046870 cadmium ion binding
• GO:0046914 transition metal ion binding
• GO:0046983 protein dimerization activity
• GO:0050897 cobalt ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006979 response to oxidative stress
• GO:0019540 catechol-containing siderophore biosynthetic process
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:1u8r, PDBe:1u8r, PDBj:1u8r
• PDBsum: 1u8r
• PubMed: 15351642
• UniProt: P9WMH1|IDER_MYCTU Iron-dependent repressor IdeR (Gene Name=ideR)