Structure of PDB 1tro Chain G Binding Site BS02

Receptor Information
>1tro Chain G (length=101) Species: 316407 (Escherichia coli str. K-12 substr. W3110) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPYSAAMAEERHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTR
VRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVL
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tro Crystal structure of trp repressor/operator complex at atomic resolution.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		T44 D46 S67 Q68 R69 I79 S86 K90
Binding residue
(residue number reindexed from 1)		T40 D42 S63 Q64 R65 I75 S82 K86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1tro, PDBe:1tro, PDBj:1tro
PDBsum1tro
PubMed3419502
UniProtP0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)

[Back to BioLiP]