Structure of PDB 1mow Chain G Binding Site BS02

Receptor Information
>1mow Chain G (length=233) Species: 2275,3055 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSGISAYLLGLIWGDGGLYKLNRSEYRVVITQKSENLIKQFIAPRMQFLI
DELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERILFNGNRFLAYLA
GIVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTERRWFLLVDEIGVGY
VRDRVSDYILSEIKPLHNFLTQLQPFLNFKQKQANLVLKIIELPSAKSPD
KFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mow Design, Activity and Structure of a Highly Specific Artificial Endonuclease
Resolution2.4 Å
Binding residue
(original residue number in PDB)		N1032 R1033 S1034 S1067 S1084 K1085 G1116 D1117 G1118 S1119 T1143 Q1144 K1145 A1230 N1233 D1234 S1235 R1238 K1239
Binding residue
(residue number reindexed from 1)		N22 R23 S24 S57 S74 K75 G105 D106 G107 S108 T132 Q133 K134 A213 N216 D217 S218 R221 K222
Enzymatic activity
Catalytic site (original residue number in PDB) G1116 D1117
Catalytic site (residue number reindexed from 1) G105 D106
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mow, PDBe:1mow, PDBj:1mow
PDBsum1mow
PubMed12419232
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI;
P21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]