Structure of PDB 1m18 Chain G Binding Site BS02

Receptor Information
>1m18 Chain G (length=106) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPKK
Ligand information
>1m18 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m18 Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
Resolution2.45 Å
Binding residue
(original residue number in PDB)
R1017 R1020 R1032 R1042 R1077
Binding residue
(residue number reindexed from 1)
R4 R7 R19 R29 R64
Binding affinityPDBbind-CN: Kd=0.6uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1m18, PDBe:1m18, PDBj:1m18
PDBsum1m18
PubMed12559907
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]