Structure of PDB 1bbz Chain G Binding Site BS02

Receptor Information
>1bbz Chain G (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPVNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bbz Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
Resolution1.65 Å
Binding residue
(original residue number in PDB)
Y7 F9 S12 D14 E35 W36 W47 P49 Y52
Binding residue
(residue number reindexed from 1)
Y7 F9 S12 D14 E35 W36 W47 P49 Y52
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1bbz, PDBe:1bbz, PDBj:1bbz
PDBsum1bbz
PubMed9698566
UniProtP00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)

[Back to BioLiP]