Structure of PDB 4v4g Chain FP Binding Site BS02

Receptor Information
>4v4g Chain FP (length=111) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATTIRRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAA
ASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKAL
ADAAREGGLDF
Ligand information
>4v4g Chain FA (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccccgugcccauagcacuguggaaccaccccaccccaugccgaacuggg
ucgugaaacacagcagcgccaaugauacucggaccgcagggucccggaaa
agucggucagcgcggggg
.<<<.<<<<.....<<.<<<<<....<<<<<<...............>>>
..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>...
....>>>..>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4g Structural basis for the control of translation initiation during stress.
Resolution11.5 Å
Binding residue
(original residue number in PDB)		T6 R14 R28 Y32 S34 K36 H37 Y39 Q41 Q49 T50 L51 A52 A53 A54 S55 G62 N63 K64 T65 Y94 K95 H97
Binding residue
(residue number reindexed from 1)		T3 R11 R25 Y29 S31 K33 H34 Y36 Q38 Q46 T47 L48 A49 A50 A51 S52 G59 N60 K61 T62 Y91 K92 H94
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 15:59:34 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v4g', asym_id = 'FP', bs = 'BS02', title = 'Structural basis for the control of translation initiation during stress.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v4g', asym_id='FP', bs='BS02', title='Structural basis for the control of translation initiation during stress.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4g', asym_id = 'FP'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4g', asym_id='FP')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>