Structure of PDB 6uub Chain FFF Binding Site BS02

Receptor Information
>6uub Chain FFF (length=277) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV
VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQ
TIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQL
DKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQD
DDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERV
RQIQVEGLRRLREILQTQGLNIEALFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uub Structural Insights into Transcription Initiation from De Novo RNA Synthesis to Transitioning into Elongation.
Resolution3.955 Å
Binding residue
(original residue number in PDB)		R112 I158 M159 T162 R163 N176 R180 R218 T220 L226 G227 E231
Binding residue
(residue number reindexed from 1)		R60 I106 M107 T110 R111 N124 R128 R166 T168 L174 G175 E179
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uub, PDBe:6uub, PDBj:6uub
PDBsum6uub
PubMed32829286
UniProtP13445|RPOS_ECOLI RNA polymerase sigma factor RpoS (Gene Name=rpoS)

[Back to BioLiP]