Structure of PDB 5j4d Chain FC Binding Site BS02

Receptor Information
>5j4d Chain FC (length=60) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKV
AHLVRVEVVE
Ligand information
>5j4d Chain HB (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga
.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j4d Structural Basis for Translation Termination on a Pseudouridylated Stop Codon.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y15 Q19 H52
Binding residue
(residue number reindexed from 1)		Y15 Q19 H52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j4d, PDBe:5j4d, PDBj:5j4d
PDBsum5j4d
PubMed27107638
UniProtQ72I22|RL30_THET2 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]