Structure of PDB 7a5k Chain F6 Binding Site BS02

Receptor Information
>7a5k Chain F6 (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRYSPEFKDPLIDKEYYRKEEKYVRELKKTQLIKAAPAGKTSSVFEDPVI
SKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNP
YTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITEC
RDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRW
W
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a5k Elongational stalling activates mitoribosome-associated quality control.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		G164 G165
Binding residue
(residue number reindexed from 1)		G123 G124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a5k, PDBe:7a5k, PDBj:7a5k
PDBsum7a5k
PubMed33243891
UniProtQ9Y2R9|RT07_HUMAN Small ribosomal subunit protein uS7m (Gene Name=MRPS7)

[Back to BioLiP]