Structure of PDB 8z9c Chain F Binding Site BS02

Receptor Information
>8z9c Chain F (length=194) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPFK
GALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASVD
FLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITISN
PQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATD
Ligand information
>8z9c Chain N (length=41) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cagaacgaagcgcaccuaauuucgaauccagcaugagaagc
.........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z9c Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.01 Å
Binding residue
(original residue number in PDB)
N36 F37 T118 D131 T132 F133 K134
Binding residue
(residue number reindexed from 1)
N34 F35 T116 D129 T130 F131 K132
External links