Structure of PDB 8z99 Chain F Binding Site BS02

Receptor Information
>8z99 Chain F (length=194) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPFK
GALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASVD
FLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITISN
PQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATD
Ligand information
>8z99 Chain N (length=46) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cagaaaaacgcgaagcgcaccuaauuucgaauccagcaugagaagc
..............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z99 Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		N36 F37 R77 R79 M93 D131 T132 F133 K134
Binding residue
(residue number reindexed from 1)		N34 F35 R75 R77 M91 D129 T130 F131 K132
External links