Structure of PDB 8vdi Chain F Binding Site BS02

Receptor Information
>8vdi Chain F (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKG
NRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vdi Structural Characterization of GC Base Pair Recognition by a Diamidine Small Molecule
Resolution1.93 Å
Binding residue
(original residue number in PDB)
R171 L172 W213 K217 N219 K221 M223 K227 Y235
Binding residue
(residue number reindexed from 1)
R3 L4 W45 K49 N51 K53 M55 K59 Y67
External links
PDB RCSB:8vdi, PDBe:8vdi, PDBj:8vdi
PDBsum8vdi
PubMed
UniProtP17947|SPI1_HUMAN Transcription factor PU.1 (Gene Name=SPI1)

[Back to BioLiP]