Structure of PDB 8uw1 Chain F Binding Site BS02

Receptor Information
>8uw1 Chain F (length=82) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAV
TYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8uw1 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggagaatccgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uw1 Cancer-associated DNA hypermethylation of Polycomb targets requires DNMT3A dual recognition of histone H2AK119 ubiquitination and the nucleosome acidic patch.
Resolution2.88 Å
Binding residue
(original residue number in PDB)		R45 I46 S47 K79 T80
Binding residue
(residue number reindexed from 1)		R25 I26 S27 K59 T60
External links