Structure of PDB 8pp6 Chain F Binding Site BS02

Receptor Information
>8pp6 Chain F (length=81) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVT
YTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8pp6 Chain J (length=156) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aatacacaggatgtatatatctgacacgtgcctggagattagggagtaat
ccccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcgg
tgctagagctgtctacgaccaattgagcggcctcggcaccgggattctcc
aggtcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pp6 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1.
Resolution3.18 Å
Binding residue
(original residue number in PDB)		R45 I46 R78 K79
Binding residue
(residue number reindexed from 1)		R24 I25 R57 K58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000228 nuclear chromosome
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pp6, PDBe:8pp6, PDBj:8pp6
PDBsum8pp6
PubMed38528151
UniProtP84040|H4_DROME Histone H4 (Gene Name=His4)

[Back to BioLiP]