Structure of PDB 8ovj Chain F Binding Site BS02

Receptor Information

>8ovj Chain F (length=148) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VSRKSPEYTTLRKSCAPGAIAIILAGRFRGRRAVILKQLPHNGPLVVSGP
MKYNGVPIRRIDSRYVIATSTTVDISSVDTAPITAEVFQRPKAEKPTLVS
DARAQLQKKIDAALIAAIKKDAQGKEKAGYLRSVFTVKPGDAPHRWNW

Ligand information

>8ovj Chain 6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca

......<.<<<............<<<<<..>>>>>......>>>......
..................>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	A43 G44 R45 R47 P62 M69 K70 G73 P75 R77 Y83 R108 L145 S147 Q154 R179 S180 V181 K185 P186
Binding residue (residue number reindexed from 1)	A25 G26 R27 R29 P44 M51 K52 G55 P57 R59 Y65 R90 L98 S100 Q107 R132 S133 V134 K138 P139

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	Q4Q4D3

[Back to BioLiP]