Structure of PDB 8kcb Chain F Binding Site BS02

Receptor Information
>8kcb Chain F (length=90) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEA
AEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8kcb Chain J (length=126) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tatgtgacacgtgcctggagactagggagtaatccccttggcggttaaaa
cgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacg
accaattgagcggcctcggcaccggg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kcb Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		R63 R72 R83 F84 Q85 S86 T118 M120
Binding residue
(residue number reindexed from 1)		R18 R27 R38 F39 Q40 S41 T73 M75
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8kcb, PDBe:8kcb, PDBj:8kcb
PDBsum8kcb
PubMed38870940
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]