Structure of PDB 8jke Chain F Binding Site BS02

Receptor Information
>8jke Chain F (length=301) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATADPVKDYLKQIGKVPLLNAEQEVELAKRIEAGLFAEDKLANSDKLAPK
LKRELEIIAEDGRRAKNHLLEANLRLVVSLAKRYTGRGMLFLDLIQEGNL
GLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVI
NKLARVQRQMLQDLGREPTPEELAKELDMTPEKVIEVQKYGREPISLHTP
LGEDGDSEFGDLIEDSEAVVPADAVSFTLLQEQLHSVLDTLSEREAGVVS
MRFGLTDGQPKTLDEIGKVYGVTRERIRQIESKTMSKLRHPSRSQVLRDY
L
Ligand information
>8jke Chain P (length=61) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgcgacggtctgacgctctacacagtgccagggggagataaacgaacgct
gaacgctccgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jke Structural and functional characterization of AfsR, a SARP family transcriptional activator of antibiotic biosynthesis in Streptomyces
Resolution3.67 Å
Binding residue
(original residue number in PDB)
R292 Y293 R296 W332 R335 Q336 R364 R367 I404 T408 P409 L410
Binding residue
(residue number reindexed from 1)
R83 Y84 R87 W123 R126 Q127 R155 R158 I195 T199 P200 L201
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001108 bacterial-type RNA polymerase holo enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8jke, PDBe:8jke, PDBj:8jke
PDBsum8jke
PubMed38427710
UniProtP18183|SIGA_STRCO RNA polymerase principal sigma factor HrdB (Gene Name=hrdB)

[Back to BioLiP]