Structure of PDB 8jg9 Chain F Binding Site BS02

Receptor Information
>8jg9 Chain F (length=171) Species: 53344 (Staphylococcus delphini) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMRKTIERLLNSELSSNSIAVRTGVSQAVISKLRNGKKELGNLTLNSAEK
LFEYQKEMEKVDTWIVYRGRTADMNKSYIAEGSTYEEVYNNFVDKYGYDV
LDEDIYEIQLLKKNGENLDDYDVDSDGINNYDKLDEFRESDYVDLEDYDY
RELFENSSSQVYYHEFEITHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jg9 Cryo-EM structure of the SaCas9-sgRNA-AcrIIA15-promoter DNA dimer
Resolution3.82 Å
Binding residue
(original residue number in PDB)		S14 S15 N16 Q26 A27 K31
Binding residue
(residue number reindexed from 1)		S15 S16 N17 Q27 A28 K32
External links