Structure of PDB 8ia3 Chain F Binding Site BS02

Receptor Information
>8ia3 Chain F (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACD
YIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQH
NLEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ia3 Tetramerization of upstream stimulating factor USF2 requires the elongated bent leucine zipper of the bHLH-LZ domain.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R237 H240 N241 E244 R248 N252 S275 K276
Binding residue
(residue number reindexed from 1)		R2 H5 N6 E9 R13 N17 S40 K41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8ia3, PDBe:8ia3, PDBj:8ia3
PDBsum8ia3
PubMed37690682
UniProtQ15853|USF2_HUMAN Upstream stimulatory factor 2 (Gene Name=USF2)

[Back to BioLiP]