Structure of PDB 8i24 Chain F Binding Site BS02

Receptor Information
>8i24 Chain F (length=233) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EHTKRIIIEYLNRIKAGDDSAREEFILRFRPFILKLVYKATDRHVEPENS
EEYSVALLAFNEAINAYDEEKHSNFLVFSEQVINRRLIDYKRKNHKNKMV
YPFSYFENEDIKLERTLSDADGNNAIERLEFTDEIRLFKSELASFDITFK
DLLSSTPKHRDSRELLINIAKKIASNDGLYEKLKKTKKLPTLELLKLAKV
SRRTIERNKKYIIAVSLILRSNLEIFKEYAAGI
Ligand information
>8i24 Chain P (length=52) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aatttcaccccttatagatagacgtataccggaatggttttatgtcgcat
tg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i24 Structure of the transcription open complex of distinct sigmaI factors
Resolution3.36 Å
Binding residue
(original residue number in PDB)		R97 D101 R104 H107 P169 K170 S213
Binding residue
(residue number reindexed from 1)		R85 D89 R92 H95 P157 K158 S201
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i24, PDBe:8i24, PDBj:8i24
PDBsum8i24
PubMed37833284
UniProtA3DH98|SIGI6_ACET2 RNA polymerase sigma factor SigI6 (Gene Name=sigI6)

[Back to BioLiP]