Structure of PDB 8i23 Chain F Binding Site BS02

Receptor Information

>8i23 Chain F (length=230) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVYDDFISTLRQIKEGNHQLREEFISEYKPFILKVTSNATGKYIDTRNSD
EFSIALSAFNEAIDKFDIEKGYNFFLFSEQVIRRRLIDYSRSNKDDKEYP
FSFFDDEYFYNNEKLLSKSYIGFEDIEAREDIEELKKKLQEFGITFLDLV
LNVPKHRDSRQLCIRLAKMLAEDEQMYNALMKNKNIPRNELKKKAKVHGR
TIGNNRKYIIALCLIFRSNLNLSKRYLEYY

Ligand information

>8i23 Chain P (length=51) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gatcattctccctagctaacgtatacatctgctttttttgtgtatattat
c

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8i23 Structure of the transcription open complex of distinct sigmaI factors
Resolution	3.03 Å
Binding residue (original residue number in PDB)	R101 I104 R108 F120 F121 Y125 K172 H173 S176 K213 V214 H215 R217 T218
Binding residue (residue number reindexed from 1)	R84 I87 R91 F103 F104 Y108 K155 H156 S159 K196 V197 H198 R200 T201

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006355	regulation of DNA-templated transcription
GO:0010468	regulation of gene expression
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i23, PDBe:8i23, PDBj:8i23
PDBsum	8i23
PubMed	37833284
UniProt	A3DBH0\|SIGI1_ACET2 RNA polymerase sigma factor SigI1 (Gene Name=sigI1)

[Back to BioLiP]