Structure of PDB 8hqy Chain F Binding Site BS02

Receptor Information
>8hqy Chain F (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAV
TYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>8hqy Chain J (length=136) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tatatctgacacgtgcctggagactagggagtaatccccttggcggttaa
aacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtcta
cgaccaattgagcggcctcggcaccgggattctcat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hqy A Cryptic Basic Groove formed by Ubiquitin and Histone H3 Mediates Selective Recognition of H2AK119Ub Nucleosomes by Synovial Sarcoma X Breakpoint 1 Protein.
Resolution3.05 Å
Binding residue
(original residue number in PDB)
R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)
R25 I26 S27 G28 R58 K59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8hqy, PDBe:8hqy, PDBj:8hqy
PDBsum8hqy
PubMed38177667
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]