Structure of PDB 8hbm Chain F Binding Site BS02

Receptor Information
>8hbm Chain F (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DELCVVCGDRASGYHYNALTCEGCKGFFRSITKNAVYKCKNGGNCVMDMY
MRRKCQECRLRKCKEMGMLAEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hbm Structural basis of the farnesoid X receptor/retinoid X receptor heterodimer on inverted repeat DNA
Resolution3.3 Å
Binding residue
(original residue number in PDB)
Y137 H138 Y139 K148 C196
Binding residue
(residue number reindexed from 1)
Y14 H15 Y16 K25 C72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8hbm, PDBe:8hbm, PDBj:8hbm
PDBsum8hbm
PubMed37287811
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]