Structure of PDB 8h7a Chain F Binding Site BS02

Receptor Information
>8h7a Chain F (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQL
ELSVKDGTILKVSNKGLNSYKDPDNPGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h7a The histone acetyltransferase KAT6A is recruited to unmethylated CpG islands via a DNA binding winged helix domain.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		Q23 K24 Q25
Binding residue
(residue number reindexed from 1)		Q22 K23 Q24
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:8h7a, PDBe:8h7a, PDBj:8h7a
PDBsum8h7a
PubMed36537216
UniProtQ92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]