Structure of PDB 8gzh Chain F Binding Site BS02

Receptor Information

>8gzh Chain F (length=314) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PYTEDSIRIYLQEIGRIRLLRAEEEIELARQIADLLELELIRDNLTLQLE
RQPSELEWGKQNKNFAAFRRRLFLDRRAKDKMVQSNLRLVVSIAKKYMNR
GLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQS
RTIRLPVHLYETISRIKKTTKLLSQEMRRKPTEEEIAEKMEMTIEKLRFI
AKSAQLPISLETPIGKEEDSRLGDFIEADGETPEDEVSKNLLREDLENVL
DTLSPRERDVLRLRYGLDDGRMKTLEEIGQIFNVTRERIRQIEAKALRKL
RHPNRNSILKEYIR

Ligand information

>8gzh Chain 2 (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgcatccgtgagtcggaggtaataaccataacggacgggccttgtcaagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8gzh Cryo-EM structure of Synechocystis sp. PCC 6803 CTP-bound RPitc
Resolution	2.96 Å
Binding residue (original residue number in PDB)	R211 S275 K279 I319 I325 F336 L386 R401
Binding residue (residue number reindexed from 1)	R100 S164 K168 I208 I214 F225 L275 R290

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006355	regulation of DNA-templated transcription
GO:0010468	regulation of gene expression
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8gzh, PDBe:8gzh, PDBj:8gzh
PDBsum	8gzh
PubMed
UniProt	P74565\|SIGA_SYNY3 RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]