Structure of PDB 8eti Chain F Binding Site BS02

Receptor Information

>8eti Chain F (length=239) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SIFAPESLLKKTKAQKQSREQIVAAAAEKKSARQKKRELIAKRAEAYEAE
YRAAEREQIELARKARAEGNYFVPHEPKLIFVVRIRGINNIPPKARKIMQ
LLRLLQINNGIFVKFNKAIKEMLQVVEPYVTYGIPNHKTVRELIYKRGFG
KVNKQRIPLSDNAIIEAALGKYSILSVEDLIHEIYTVGPNFKQAANFLWP
FKLSSPLGGWRERKFKHFIEGGDAGKRDEHINGLVQKML

Ligand information

>8eti Chain T (length=23) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QPAPPAKAHFVSTENNEPVTLHP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8eti Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	L72 N81 Y82 F83 V84 P85 H86 E87 K128
Binding residue (residue number reindexed from 1)	L61 N70 Y71 F72 V73 P74 H75 E76 K117

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8eti, PDBe:8eti, PDBj:8eti
PDBsum	8eti
PubMed	36423630
UniProt	P25457\|RL7B_SCHPO Large ribosomal subunit protein uL30B (Gene Name=rpl702)

[Back to BioLiP]