Structure of PDB 8eth Chain F Binding Site BS02

Receptor Information
>8eth Chain F (length=239) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIFAPESLLKKTKAQKQSREQIVAAAAEKKSARQKKRELIAKRAEAYEAE
YRAAEREQIELARKARAEGNYFVPHEPKLIFVVRIRGINNIPPKARKIMQ
LLRLLQINNGIFVKFNKAIKEMLQVVEPYVTYGIPNHKTVRELIYKRGFG
KVNKQRIPLSDNAIIEAALGKYSILSVEDLIHEIYTVGPNFKQAANFLWP
FKLSSPLGGWRERKFKHFIEGGDAGKRDEHINGLVQKML
Ligand information
>8eth Chain T (length=18) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AHFVSTENNEPVTLHPVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eth Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		N81 Y82 F83 V84 H86
Binding residue
(residue number reindexed from 1)		N70 Y71 F72 V73 H75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eth, PDBe:8eth, PDBj:8eth
PDBsum8eth
PubMed36423630
UniProtP25457|RL7B_SCHPO Large ribosomal subunit protein uL30B (Gene Name=rpl702)

[Back to BioLiP]