Structure of PDB 8etc Chain F Binding Site BS02

Receptor Information
>8etc Chain F (length=218) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVAAAAEKKSARQKKRELIAKRAEAYEAEYRAAEREQIELARKARAEGNY
FVPHEPKLIFVVRIRGINNIPPKARKIMQLLRLLQINNGIFVKFNKAIKE
MLQVVEPYVTYGIPNHKTVRELIYKRGFGKVNKQRIPLSDNAIIEAALGK
YSILSVEDLIHEIYTVGPNFKQAANFLWPFKLSSPLGGWRERKFKHFIEG
GDAGKRDEHINGLVQKML
Ligand information
>8etc Chain T (length=21) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APPAKAHFVSTENNEPVTLHP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8etc Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		L72 K75 N81 Y82 V84 H86 E87 K128
Binding residue
(residue number reindexed from 1)		L40 K43 N49 Y50 V52 H54 E55 K96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8etc, PDBe:8etc, PDBj:8etc
PDBsum8etc
PubMed36423630
UniProtP25457|RL7B_SCHPO Large ribosomal subunit protein uL30B (Gene Name=rpl702)

[Back to BioLiP]