Structure of PDB 8ej6 Chain F Binding Site BS02

Receptor Information
>8ej6 Chain F (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKG
NRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ej6 DNA selection by the master transcription factor PU.1.
Resolution1.39 Å
Binding residue
(original residue number in PDB)
R171 W213 K217 N219 K221 M223 K227 Y235
Binding residue
(residue number reindexed from 1)
R3 W45 K49 N51 K53 M55 K59 Y67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8ej6, PDBe:8ej6, PDBj:8ej6
PDBsum8ej6
PubMed37352101
UniProtP17947|SPI1_HUMAN Transcription factor PU.1 (Gene Name=SPI1)

[Back to BioLiP]