Structure of PDB 7xcr Chain F Binding Site BS02

Receptor Information
>7xcr Chain F (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN
VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>7xcr Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xcr H2B Lys34 Ubiquitination Induces Nucleosome Distortion to Stimulate Dot1L Activity.
Resolution2.57 Å
Binding residue
(original residue number in PDB)		R45 I46 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R31 I32 G34 R64 K65 T66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:7xcr, PDBe:7xcr, PDBj:7xcr
PDBsum7xcr
PubMed35739357
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]