Structure of PDB 7x5m Chain F Binding Site BS02

Receptor Information

>7x5m Chain F (length=170) Species: 4006 (Linum usitatissimum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VEYDVFLSFRGPDTRKQFTDFLYHFLCYYKIHTFRDDDELRKGKEIGPNL
LRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMV
DPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDLKGWHIGKDD
EQGAIADKVSADIWSHISKE

Ligand information

>7x5m Chain E (length=5) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

attta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7x5m TIR domains of plant immune receptors are 2',3'-cAMP/cGMP synthetases mediating cell death.
Resolution	3.42 Å
Binding residue (original residue number in PDB)	R99 K130
Binding residue (residue number reindexed from 1)	R41 K72

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0007165	signal transduction

View graph for
Biological Process

External links

PDB	RCSB:7x5m, PDBe:7x5m, PDBj:7x5m
PDBsum	7x5m
PubMed	35597242
UniProt	Q9XEH4

[Back to BioLiP]