Structure of PDB 7vp5 Chain F Binding Site BS02

Receptor Information
>7vp5 Chain F (length=74) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIVEVQGGHIIRATGRKDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDR
LGYDRPSKAVDWLIKKAKTAIDKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vp5 Structural basis for DNA recognition by TCP transcription factors
Resolution2.992 Å
Binding residue
(original residue number in PDB)		K30 D31 R46 R48
Binding residue
(residue number reindexed from 1)		K17 D18 R33 R35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:7vp5, PDBe:7vp5, PDBj:7vp5
PDBsum7vp5
PubMed
UniProtO82277|TCP10_ARATH Transcription factor TCP10 (Gene Name=TCP10)

[Back to BioLiP]