Structure of PDB 7ux9 Chain F Binding Site BS02

Receptor Information
>7ux9 Chain F (length=95) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAV
LALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7ux9 Chain Z (length=141) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atgtatatatgtgacacgtgcctggagactagggagtaatccccttggcg
gttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagct
gtctacgaccaattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ux9 Chromatin remodeling of histone H3 variants by DDM1 underlies epigenetic inheritance of DNA methylation.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V46 R49 L65
Binding residue
(residue number reindexed from 1)		V7 R10 L26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005886 plasma membrane
GO:0030875 rDNA protrusion

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7ux9, PDBe:7ux9, PDBj:7ux9
PDBsum7ux9
PubMed37643610
UniProtP59169|H33_ARATH Histone H3.3 (Gene Name=HTR4)

[Back to BioLiP]