Structure of PDB 7uvv Chain F Binding Site BS02

Receptor Information
>7uvv Chain F (length=174) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAATDKKLLDGA
VADMQLIAGQKPVVTLARKSIAGFKIRDGWPIGCKVTLRGDQMYEFLDRL
ISIAIPRIRDFRGFSAKSFDGRGNYSMGLKEQIVFPEIDFDKIDRIRGMD
ITITTTARTDDEGRALMRAFGFPF
Ligand information
>7uvv Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu
<<<<<<<<.....<<<<<<<.....<<<<<<<.............>>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uvv Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		N24 M26 E27 Q63 K64 V66 V67 T90 R92
Binding residue
(residue number reindexed from 1)		N21 M23 E24 Q60 K61 V63 V64 T87 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvv, PDBe:7uvv, PDBj:7uvv
PDBsum7uvv
PubMed37192172
UniProtB7IA27|RL5_ACIB5 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]