Structure of PDB 7pah Chain F Binding Site BS02

Receptor Information
>7pah Chain F (length=154) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKNRAPKRTVLPDPVFNNTLVTRIINVIMEDGKKGLAQRILYGAFDLIEQ
RTKEKPLTVFERAVGNVMPRLELRVRRIAGSNYQVPTEVPQDRKIALALR
WIAMFARKRHEKTMLEKIANEIIDASNNTGAAIKKKDDTHKMAEANKAFA
HMRW
Ligand information
>7pah Chain 8 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucuuguagcucagucgguagagcaacggucugaagaaccgugugucgg
caguucgauucugcccgagaccacca
<<<<<<...<<<<........>>>>..<<<<.......>>>>......<<
<<<.......>>>>>.>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pah Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution9.5 Å
Binding residue
(original residue number in PDB)		N83 K142
Binding residue
(residue number reindexed from 1)		N82 K141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pah, PDBe:7pah, PDBj:7pah
PDBsum7pah
PubMed36171285
UniProtP75545|RS7_MYCPN Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]