Structure of PDB 7oa5 Chain F Binding Site BS02

Receptor Information
>7oa5 Chain F (length=184) Species: 272631 (Mycobacterium leprae TN) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAM
VVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQA
LADSDVASLTRVPGIGKRGAERIVLELRDKVNAVRGSVVEALVGLGFAAK
QAEEATDQVLDGELGKVATSSALRAALSLLGKTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oa5 Crystal structure of an octameric RuvA-Holliday junction complex
Resolution2.378 Å
Binding residue
(original residue number in PDB)		S78 G79 V80 G81 P82 R83 L84 A164
Binding residue
(residue number reindexed from 1)		S78 G79 V80 G81 P82 R83 L84 A148
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0005524 ATP binding
GO:0009378 four-way junction helicase activity
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0032508 DNA duplex unwinding
Cellular Component
GO:0005737 cytoplasm
GO:0009379 Holliday junction helicase complex
GO:0048476 Holliday junction resolvase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oa5, PDBe:7oa5, PDBj:7oa5
PDBsum7oa5
PubMed
UniProtP40832|RUVA_MYCLE Holliday junction branch migration complex subunit RuvA (Gene Name=ruvA)

[Back to BioLiP]