Structure of PDB 7nz0 Chain F Binding Site BS02

Receptor Information

>7nz0 Chain F (length=198) Species: 230089 (Photorhabdus thracensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FMPVKLAQALANSLFPELDSQLRAGRHIGIDDLDNHAFLMDFQEQLEEFY
ARYNVELIRAPEGFFYLRPRSTTLIPRSVLSELDMMVGKILCYLYLSPER
LANQGIFTSQELYEELISLADEGKLMKFVNQRSSGSDLDKQKLQEKVRTT
LNRLRRLGMVYFLPNNNNKFTITEAVFRFGADVRSGDDPREIQLRMIR

Ligand information

>7nz0 Chain N (length=30) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atatatatatatatatatatatatatatat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7nz0 Cryo-EM structure of MukBEF reveals DNA loop entrapment at chromosomal unloading sites.
Resolution	6.3 Å
Binding residue (original residue number in PDB)	S86 V87
Binding residue (residue number reindexed from 1)	S78 V79

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006260	DNA replication
GO:0007059	chromosome segregation
GO:0030261	chromosome condensation
GO:0051301	cell division

	Cellular Component
GO:0005737	cytoplasm
GO:0009295	nucleoid

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nz0, PDBe:7nz0, PDBj:7nz0
PDBsum	7nz0
PubMed	34739874
UniProt	A0A0F7LPV6

[Back to BioLiP]