Structure of PDB 7msm Chain F Binding Site BS02

Receptor Information

>7msm Chain F (length=178) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLI
NGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFL
DRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVR
GMDINVVTSAATDDEGRALLRALGFPFK

Ligand information

>7msm Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca

<<.<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.......
>>...>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7msm Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Resolution	2.79 Å
Binding residue (original residue number in PDB)	N31 M33 Q34 Q70 K71 E73 R95 V96 T97 R99
Binding residue (residue number reindexed from 1)	N24 M26 Q27 Q63 K64 E66 R88 V89 T90 R92

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7msm, PDBe:7msm, PDBj:7msm
PDBsum	7msm
PubMed	35064151
UniProt	P9WH83\|RL5_MYCTU Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]