Structure of PDB 7msc Chain F Binding Site BS02

Receptor Information
>7msc Chain F (length=178) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLI
NGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFL
DRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVR
GMDINVVTSAATDDEGRALLRALGFPFK
Ligand information
>7msc Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca
<..<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.......
>>...>>>>>>.>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7msc Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		N31 Q34 K71 E73 V74 R95 V96 T97 R99 R102
Binding residue
(residue number reindexed from 1)		N24 Q27 K64 E66 V67 R88 V89 T90 R92 R95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msc, PDBe:7msc, PDBj:7msc
PDBsum7msc
PubMed35064151
UniProtP9WH83|RL5_MYCTU Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]