Structure of PDB 7k6p Chain F Binding Site BS02

Receptor Information
>7k6p Chain F (length=87) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENV
IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>7k6p Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggagaatccgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k6p Regulation of the Dot1 histone H3K79 methyltransferase by histone H4K16 acetylation.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		T30 P32 R36 R45
Binding residue
(residue number reindexed from 1)		T15 P17 R21 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7k6p, PDBe:7k6p, PDBj:7k6p
PDBsum7k6p
PubMed33479126
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]