Structure of PDB 7f75 Chain F Binding Site BS02

Receptor Information

>7f75 Chain F (length=272) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DPVRMYLKEIGRVNLLSAKEEIAYAQKIEEGDEESKRRLAEANLRLVVSI
AKRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYKFSTYATWWIRQAIT
RAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGREPTPEEIAEDMDLT
PEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEATSPSDHAAYELL
KEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQI
EAKALRKLRHPSRSKRLKDFLE

Ligand information

>7f75 Chain K (length=63) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgcatccgtgagtcgagggtaataaagcatctcccattcgttcacgctat
tttaatgcttaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7f75 Structural basis of transcription activation by the global regulator Spx.
Resolution	4.2 Å
Binding residue (original residue number in PDB)	Y153 G155 R156 R224 I270 F281 L332 E333
Binding residue (residue number reindexed from 1)	Y54 G56 R57 R125 I171 F182 L233 E234

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006355	regulation of DNA-templated transcription
GO:0010468	regulation of gene expression
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f75, PDBe:7f75, PDBj:7f75
PDBsum	7f75
PubMed	34530448
UniProt	P06224\|SIGA_BACSU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]