Structure of PDB 7e9f Chain F Binding Site BS02

Receptor Information
>7e9f Chain F (length=81) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSV
TYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
Ligand information
>7e9f Chain J (length=126) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tctgacacgtgcctggagactagggagtaatccccttggcggttaaaacg
cgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgac
caattgagcggcctcggcaccgggat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e9f Nucleosome binding relinquishes the association of the BAH domain of Orc1 with Sir1
Resolution4.0 Å
Binding residue
(original residue number in PDB)		R35 R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R15 R25 I26 S27 G28 R58 K59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006355 regulation of DNA-templated transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0045943 positive regulation of transcription by RNA polymerase I
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e9f, PDBe:7e9f, PDBj:7e9f
PDBsum7e9f
PubMed
UniProtP02309|H4_YEAST Histone H4 (Gene Name=HHF1)

[Back to BioLiP]