Structure of PDB 7e1b Chain F Binding Site BS02

Receptor Information
>7e1b Chain F (length=208) Species: 670 (Vibrio parahaemolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQTLLLVEDDKNLADGLLVSLEQAGYECLHVERIADVEPQWKKADLVILD
RQLPDGDSVQHLPEWKKIKDVPVILLTALVTVKDKVAGLDSGANDYLTKP
FAEAELFARIRAQLRANADKVMTKDLEIDRATREVIFKGDLITLTRTEFD
LLLFLASNLGRVFTRDELLDHVWGYNTRTVDTHVLQLRQKLPGLEIETLR
GVGYKMKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e1b Structural basis of phosphorylation-induced activation of the response regulator VbrR.
Resolution4.587 Å
Binding residue
(original residue number in PDB)		R173 T194 L197 Q201 T210 R212 G213 V214 Y216
Binding residue
(residue number reindexed from 1)		R165 T182 L185 Q189 T198 R200 G201 V202 Y204
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e1b, PDBe:7e1b, PDBj:7e1b
PDBsum7e1b
PubMed36647726
UniProtQ87HP4

[Back to BioLiP]