Structure of PDB 7d7c Chain F Binding Site BS02

Receptor Information
>7d7c Chain F (length=137) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVNNKELLQAIIDWKTELANVRQNDTIGLAIMLIAEGLSKRFNFSGYTQS
WKQEMIADGIEASIKGLHNFDETKYKNPHAYITQACFNAFVQRIKKERKE
VAKKYSYFVHNVYDSRDDDMVALVDETFIQDIYDKMT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d7c Transcription activation by a sliding clamp.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y10 G53 L54 K90 Y91 H95 Y97 Q100 A101 N104
Binding residue
(residue number reindexed from 1)		Y1 G37 L38 K74 Y75 H79 Y81 Q84 A85 N88
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 23:54:01 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7d7c', asym_id = 'F', bs = 'BS02', title = 'Transcription activation by a sliding clamp.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7d7c', asym_id='F', bs='BS02', title='Transcription activation by a sliding clamp.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003677,2000142', uniprot = '', pdbid = '7d7c', asym_id = 'F'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,2000142', uniprot='', pdbid='7d7c', asym_id='F')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>