Structure of PDB 7d69 Chain F Binding Site BS02

Receptor Information
>7d69 Chain F (length=78) Species: 5741 (Giardia intestinalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTLGGITKPAIRRLARRGGVKRISSTIYQQTREVLKAFLEVVLRDSLTYT
EHGQRKTVTSQDVVYALKRQGRTLYGFG
Ligand information
>7d69 Chain J (length=125) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgc
acgtacggattccgtacgtgcgtttaagcggtgctagagctgtctacgac
caattgagcggcctcggcaccggga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d69 Cryo-EM structure of the nucleosome core particle containing Giardia lamblia histones.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		T26 P28 R32 R41
Binding residue
(residue number reindexed from 1)		T7 P9 R13 R22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d69, PDBe:7d69, PDBj:7d69
PDBsum7d69
PubMed34352093
UniProtA8BUJ9

[Back to BioLiP]