Structure of PDB 6xxs Chain F Binding Site BS02

Receptor Information
>6xxs Chain F (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLYLRPGDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHK
TVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNL
REGNIMAVMATAMYLQMEHVVDTCRKFIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xxs Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone.
Resolution3.25 Å
Binding residue
(original residue number in PDB)
D6 Q8 I9 Q10 F11 T12 R13 H14 D17 V18 N21 R24 L25 R28
Binding residue
(residue number reindexed from 1)
D9 Q11 I12 Q13 F14 T15 R16 H17 D20 V21 N24 R27 L28 R31
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xxs, PDBe:6xxs, PDBj:6xxs
PDBsum6xxs
PubMed33708392
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]