Structure of PDB 6wu9 Chain F Binding Site BS02

Receptor Information
>6wu9 Chain F (length=177) Species: 474186 (Enterococcus faecalis OG1RF) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRLKEKYIKEVTPSLVEKFNYSSVMQTPKVDKIVINMGVGDAVSNAKNLD
KAVEELALITGQKPLITKAKKSIAGFRLREGMPIGAKVTLRGERMYEFLD
KLVTVSLPRVRDFHGVSKKAFDGRGNYTLGIKEQLIFPEVDYDLVDKVRG
MDIVIVTTANTDEESRELLAQLGMPFQ
Ligand information
>6wu9 Chain B (length=116) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugugguggcgauagcgagaaggauacaccuguucccaugccgaacacaga
aguuaagcuucuuagcgccgauuguagugaaggguuucccuuugugagag
uaggacgucgccacgc
<<<<<<<<<....<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<.....<.<<<<<<<<...>>>>>>>>...>.
..>>..>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wu9 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		M26 Q27 Q63 K64 L66 T90 R92
Binding residue
(residue number reindexed from 1)		M25 Q26 Q62 K63 L65 T89 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wu9, PDBe:6wu9, PDBj:6wu9
PDBsum6wu9
PubMed33004869
UniProtQ839F2|RL5_ENTFA Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]