Structure of PDB 6vvy Chain F Binding Site BS02

Receptor Information
>6vvy Chain F (length=322) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEA
GLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVS
LAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAI
TRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDI
TPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTL
LQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQ
IESKTMSKLRHPSRSQVLRDYL
Ligand information
>6vvy Chain P (length=65) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcccgcttcggggcaaccctgccagtctaatacaaatccggcaatggag
tcaagaccaggttcg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vvy The antibiotic sorangicin A inhibits promoter DNA unwinding in a Mycobacterium tuberculosis rifampicin-resistant RNA polymerase.
Resolution3.42 Å
Binding residue
(original residue number in PDB)		Y310 R313 W349 R381 R384 E419 I421 S422 Q425 I427 E430 F438 R478 T488 L489 R500 E501
Binding residue
(residue number reindexed from 1)		Y105 R108 W144 R176 R179 E214 I216 S217 Q220 I222 E225 F233 R273 T283 L284 R295 E296
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vvy, PDBe:6vvy, PDBj:6vvy
PDBsum6vvy
PubMed33199626
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]