Structure of PDB 6v3d Chain F Binding Site BS02

Receptor Information

>6v3d Chain F (length=175) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAATDKKLLDG
AVADMQLIAGQKPVVTLARKSIAGFKIRDGWPIGCKVTLRGDQMYEFLDR
LISIAIPRIRDFRGFSAKSFDGRGNYSMGLKEQIVFPEIDFDKIDRIRGM
DITITTTARTDDEGRALMRAFGFPF

Ligand information

>6v3d Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu

<<<<<<<<.....<<<<<<<.....<<<.<<...............>>..
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6v3d Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	N24 M26 E27 Q63 K64 T90 R92
Binding residue (residue number reindexed from 1)	N22 M24 E25 Q61 K62 T88 R90

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6v3d, PDBe:6v3d, PDBj:6v3d
PDBsum	6v3d
PubMed	31964740
UniProt	B7IA27\|RL5_ACIB5 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]